You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584021 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDGF B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27kDa |
Target | PDGFB |
UniProt ID | P01127 |
Protein Sequence | Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
NCBI | NP_002599 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PDGFB, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PDGFB, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Immunohistochemistry with Uterus tissue at an antibody concentration of 5 ug/ml using anti-PDGFB antibody (orb584021).
Rabbit Anti-PDGFB Antibody, Catalog Number: orb584021, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-PDGFB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that PDGFB is expressed in HEK293T.
WB Suggested Anti-PDGFB antibody Titration: 1 ug/ml, Sample Type: Human liver.
FC, ICC, IP, WB | |
Mouse | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating