You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579570 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDE9A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 61kDa |
Target | PDE9A |
UniProt ID | O76083 |
Protein Sequence | Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET |
NCBI | NP_001001581 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HSPDE9A2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Host: Rabbit, Target Name: PDE9A, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Lane 1: 5 ug in vitro translation without DNA, Lane 2: 5 ug in vitro translation hNeur1-pcDNA3, Lane 3: 60 ug in vitro translation rNeur1-pcDNA3, Lane 4: 60 ug HEK293 cell lysate (not transfected), Lane 5: 60 ug hNeur1-pcDNA3 overexpressed in HEK293 cells, Lane 6: 60 ug rNeur1-pcDNA3 overexpressed in HEK293 cells. Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: PDE9A.
WB Suggested Anti-PDE9A Antibody Titration: 1.0 ug/ml, Positive Control: Jurkat cell lysate.
WB Suggested Anti-PDE9A Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Mouse Brain lysate.
Filter by Rating