You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574476 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PCYOX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PCYOX1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57kDa |
Target | PCYOX1 |
UniProt ID | Q9UHG3 |
Protein Sequence | Synthetic peptide located within the following region: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY |
NCBI | NP_057381 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PCL1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Liver
Rabbit Anti-PCYOX1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PCYOX1 Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate.
Filter by Rating