PCSK1 antibody

• Catalog Number: orb574845
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCSK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCSK1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 84 kDa
• Target: PCSK1
• UniProt ID: P29120
• Protein Sequence: Synthetic peptide located within the following region: QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK
• NCBI: NP_000430
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PC1, PC3, NEC1, SPC3, BMIQ12
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

Host: Rabbit, Target Name: PCSK1, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: PCSK1, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Pancreas tissue at an antibody concentration of 5 ug/ml using anti-PCSK1 antibody (orb574845).

WB Suggested Anti-PCSK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Small Intestine.