PCK1 antibody

• Catalog Number: orb574391
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCK1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: PCK1
• UniProt ID: P35558
• Protein Sequence: Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
• NCBI: NP_002582
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PCKDC, PEPCK1, PEPCKC, PEPCK-C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: PCK1, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PCK1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Human kidney

WB Suggested Anti-PCK1 Antibody Titration: 1.0 ug/ml, Positive Control: Fetal Brain Lysate.