Cart summary

You have no items in your shopping cart.

    PCK1 antibody

    Catalog Number: orb574390

    DispatchUsually dispatched within 3-7 working days
    $ 609.00
    Catalog Numberorb574390
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to PCK1
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
    ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PCK1
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW69 kDa
    TargetPCK1
    UniProt IDP35558
    Protein SequenceSynthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
    NCBINP_002582
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesPCKDC, PEPCK1, PEPCKC, PEPCK-C
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    PCK1 antibody

    25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

    PCK1 antibody

    Host: Rabbit, Target Name: PCK1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

    PCK1 antibody

    WB Suggested Anti-PCK1 Antibody, Positive Control: Lane 1: 80 ug pig serum, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.

    PCK1 antibody

    WB Suggested Anti-PCK1 Antibody, Positive Control: Lane 1: 80 ug pig serum protein, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:500.

    PCK1 antibody

    WB Suggested Anti-PCK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

    • PCK1 antibody [orb574391]

      IHC,  WB

      Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

      Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • PCK1 Antibody [orb1243713]

      ELISA,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • PCK1 Antibody [orb1243712]

      ELISA,  IHC,  WB

      Canine, Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • PCK1/PEPC Antibody [orb654454]

      ELISA,  FC,  ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • PEPCK-C antibody [orb766841]

      ELISA,  IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      50ul, 100ul
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars