You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574390 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PCK1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCK1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 69 kDa |
Target | PCK1 |
UniProt ID | P35558 |
Protein Sequence | Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
NCBI | NP_002582 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PCKDC, PEPCK1, PEPCKC, PEPCK-C Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: PCK1, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PCK1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-PCK1 Antibody, Positive Control: Lane 1: 80 ug pig serum, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.
WB Suggested Anti-PCK1 Antibody, Positive Control: Lane 1: 80 ug pig serum protein, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:500.
WB Suggested Anti-PCK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating