PCBP4 antibody

• Catalog Number: orb330151
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCBP4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCBP4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: PCBP4
• UniProt ID: Q9GZT1
• Protein Sequence: Synthetic peptide located within the following region: QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV
• NCBI: NP_065151
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CBP antibody, anti LIP4 antibody, anti MCG10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: PCBP4, Sample Tissue: Human Ovary Tumor, Human 293T, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-PCBP4 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.