PCBP2 antibody

• Catalog Number: orb330136
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCBP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCBP2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: PCBP2
• UniProt ID: Q6IPF4
• Protein Sequence: Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
• NCBI: NP_005007
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HNRPE2 antibody, anti hnRNP-E2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: PCBP2, Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: PCBP2, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PCBP2 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PCBP2 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat.