PCBP1 antibody

• Catalog Number: orb330139
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCBP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PCBP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37 kDa
• Target: PCBP1
• UniProt ID: Q15365
• Protein Sequence: Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
• NCBI: NP_006187
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HNRPE1 antibody, anti HNRPX antibody, anti hn
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human spleen tissue using PCBP1 antibody

Immunohistochemical staining of human Breast tissue using PCBP1 antibody

Western blot analysis of human MCF7 tissue using PCBP1 antibody

Immunohistochemical staining of human Breast tissue using PCBP1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.

Anti-PCBP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Host: Mouse, Target Name: PCBP1, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: PCBP1, Sample Tissue: Human HCT116, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: PCBP1, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: PCBP1, Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, PCBP1 is supported by BioGPS gene expression data to be expressed in MCF7.

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.