You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb413076 |
---|---|
Category | Antibodies |
Description | PBP/PEBP1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Reactivity | Human, Mouse |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human PBP (DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 21 kDa |
UniProt ID | P30086 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Phosphatidylethanolamine-binding protein 1; PEBP-1 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HepG2 cells using anti-PBP antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of PBP using anti-PBP antibody.Lane 1:human HeLa cell; 2:human MCF-7 cell; 3:human HepG2 cell; 4:human 293T cell; 5:mouse testis lysates.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human sarcoma tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of mouse kidney tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human liver cancer tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human endometrial carcinoma tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human tonsil tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human pancreatic cancer tissue.
Filter by Rating