You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329645 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAX4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAX4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38 kDa |
Target | PAX4 |
UniProt ID | O43316 |
Protein Sequence | Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
NCBI | NP_006184 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti KPD antibody, anti MGC129960 antibody, anti M Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Host: Rabbit, Target Name: PAX4, Sample Tissue: Human NCI-H226, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: PAX4, Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, PAX4 is supported by BioGPS gene expression data to be expressed in COLO205.
Host: Rabbit, Target Name: PAX4, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: PAX4, Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, PAX4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.
Host: Rat, Target Name: PAX4, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.
Filter by Rating