PANX1 antibody

• Catalog Number: orb578598
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PANX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PANX1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: PANX1
• UniProt ID: Q96RD7
• Protein Sequence: Synthetic peptide located within the following region: LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN
• NCBI: NP_056183
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PX1, MRS1, OOMD7, UNQ2529
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: PANX1, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PANX1, Sample Type: Hela whole cell lysates, Antibody Dilution: 1.0 ug/ml. PANX1 is supported by BioGPS gene expression data to be expressed in HeLa.

Human Intestine

Host: Rabbit, Target Name: PANX1, Sample Type: Human Jurkat cell lysate, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-PANX1 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: Mouse Retina and Knockout PANX-1 Mouse Tissue.

WB Suggested Anti-PANX1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.