PAFAH1B1 antibody

• Catalog Number: orb330824
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAFAH1B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: PAFAH1B1
• UniProt ID: P43034
• Protein Sequence: Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
• NCBI: NP_000421
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LIS1 antibody, anti LIS2 antibody, anti MDCR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of MCF7 cell lysate tissue using PAFAH1B1 antibody

Host: Mouse, Target Name: PAFAH1B1, Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: PAFAH1B1, Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Rabbit Anti-PAFAH1B1 Antibody, Catalog Number: orb330824, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PAFAH1B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that PAFAH1B1 is expressed in MCF7.