You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585035 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAF1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | PAF1 |
UniProt ID | Q8N7H5 |
Protein Sequence | Synthetic peptide located within the following region: IQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQ |
NCBI | NP_061961 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PD2, F23149_1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PAF1, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PAF1 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: PAF1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PAF1, Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. PAF1 is supported by BioGPS gene expression data to be expressed in HeLa.
Rabbit Anti-PAF1 Antibody, Catalog Number: orb585035, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PAF1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
Filter by Rating