You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573617 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to p53 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TP53 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44 kDa |
Target | TP53 |
UniProt ID | P04637 |
Protein Sequence | Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
NCBI | NP_000537 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P53, BCC7, LFS1, BMFS5, TRP53 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with U20S/ PLKO cells tissue.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 44 kDa isoform is identified, and a second isoform of 34 kDa is also present in some samples. TP53 has > 12 isoforms, and this peptide is present in isoform 1, 2, 3, 6, and others.
Host: Rabbit, Target Name: TP53, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: TP53, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: TP53, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Immunohistochemistry with U20S/ PLKO cells tissue.
Rabbit Anti-TP53 Antibody, Catalog Number: orb573617, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: U20S/ PLKO cells.
WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
ChIP, ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FACS, IF, IHC-P, WB | |
Human, Mouse | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit, Sheep, Xenopus | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FACS, IF, IHC-P, WB | |
Human, Mouse | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating