p53 antibody

• Catalog Number: orb333708
• Category: Antibodies
• Description: Rabbit polyclonal antibody to p53
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: Trp53
• UniProt ID: Q549C9
• Protein Sequence: Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY
• NCBI: NP_035770
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BCC7 antibody, anti FLJ92943 antibody, anti H
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of SP2/0 cell lysate tissue using p53 antibody

Western blot analysis of KO HCT-116 cells tissue using p53 antibody

Host: Rabbit, Target Name: TP53, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Host: Mouse, Target Name: TP53, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TRP53 Antibody, Positive Control: Lane 1: 40 ug C57/B6 control mouse G.I, Lane 2: 40 ug C57/B6 mouse G.I. treated with Irinotecan, Lane 3: 40 ug p53 KO HCT-116 cells Lane 4: 40 ug C57/B6 mouse treated with 15 Gy ionizing radiation, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:2500.

WB Suggested Anti-Trp53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.