P4HB Rabbit Polyclonal Antibody

• Catalog Number: orb580304
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P4HB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human P4HB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: P4HB
• UniProt ID: P07237
• Protein Sequence: Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV
• NCBI: NP_000909
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DSI, GIT, PDI, PHDB, PDIA1, PO4DB, PO4HB, PROHB, C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-P4HB Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate. P4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.