You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585853 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to P2RY11 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | P2RY11 |
UniProt ID | Q96G91 |
Protein Sequence | Synthetic peptide located within the following region: VPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ |
NCBI | NP_002557 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P2Y11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: P2RY11, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: P2RY11, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-P2RY11 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.
Filter by Rating