P2RX7 antibody

• Catalog Number: orb575528
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P2RX7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX7
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: P2RX7
• UniProt ID: Q99572
• Protein Sequence: Synthetic peptide located within the following region: IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P2X7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: P2RX7, Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target: P2RX7, Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-P2RX7 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.