You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575375 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to P2RX7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human P2RX7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 68kDa |
Target | P2RX7 |
UniProt ID | Q99572 |
Protein Sequence | Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP |
NCBI | NP_002553 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P2X7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: P2RX7, Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-P2RX7 Antibody, Positive Control: Lane 1: 50 ug mock transfected HEK-293, Lane 2: 50 ug hP2X7 transfected HEK-293, Lane 3: 50 ug mP2X7 transfected HEK-293, Lane 4: 50 ug rP2X7 transfected HEK-293, Primary Antibody Dilution: 1:625, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1000.
WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Stomach.
ELISA, FC, IF, IHC, WB | |
Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating