You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1147065 |
---|---|
Category | Proteins |
Description | Endogenous glucagon like peptide receptor agonist; Peptides. |
CAS Number | 62340-29-8 |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
MW | 4421.86 Da |
Formula | C192H295N59O60S |
Solubility (25°C) | Soluble in dilute acid |
Protein Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Storage | Store dry, dark and frozen |
Alternative names | feeding, 62340-29-8GH070, GLP-1), Glucagon 37, HSQ Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
IF, IHC | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P | |
Bovine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating