You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330562 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Oxsr1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58 kDa |
Target | Oxsr1 |
UniProt ID | Q6P9R2 |
Protein Sequence | Synthetic peptide located within the following region: RAPTISERSKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGRAAISQ |
NCBI | NP_598746 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 2210022N24Rik antibody, anti 2810422B09Rik an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.
WB Suggested Anti-Oxsr1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating