OTUB1 antibody

• Catalog Number: orb330908
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OTUB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: OTUB1
• UniProt ID: Q96FW1
• Protein Sequence: Synthetic peptide located within the following region: KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
• NCBI: NP_060140
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ20113 antibody, anti FLJ40710 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HEK293T tissue using OTUB1 antibody

Western blot analysis of HepG2 cell lysate tissue using OTUB1 antibody

Host: Rabbit, Target Name: OTUB1, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. OTUB1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

WB Suggested Anti-OTUB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. OTUB1 is strongly supported by BioGPS gene expression data to be expressed in HepG2.