OSMR antibody

• Catalog Number: orb579775
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OSMR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSMR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 111 kDa
• Target: OSMR
• UniProt ID: Q99650
• Protein Sequence: Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
• NCBI: NP_003990
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OSMRB, PLCA1, IL-31RB, OSMRbeta, IL-31R-beta
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. In addition to the canonical isoform at 111 kDa, the peptide sequence is present in isoforms of ~88 kDa, ~64 kDa, and ~40 kDa. The protein may further by modified by glycosylation and/or phosphorylation.

Host: Rabbit, Target Name: OSMR, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate. OSMR is supported by BioGPS gene expression data to be expressed in HT1080.