You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583421 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to OSGEP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OSGEP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36kDa |
Target | OSGEP |
UniProt ID | Q9NPF4 |
Protein Sequence | Synthetic peptide located within the following region: PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA |
NCBI | NP_060277 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | KAE1, TCS3, GCPL1, GAMOS3, OSGEP1, PRSMG1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
OSGEP was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb583421 with 1:200 dilution. Western blot was performed using orb583421 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: OSGEP IP with orb583421 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.
IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating