You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580986 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ORAI2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ORAI2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | ORAI2 |
UniProt ID | Q96SN7 |
Protein Sequence | Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ |
NCBI | NP_116220 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CBCIP2, C7orf19, MEM142B, TMEM142B Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: ORAI2, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ORAI2, Sample Tissue: Human PC-3 Whole Cell, Antibody dilution: 5 ug/ml.
WB Suggested Anti-ORAI2 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
ELISA, ICC, IF, WB | |
Gallus | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating