OPRPN antibody

• Catalog Number: orb588868
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OPRPN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5AR1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: OPRPN
• UniProt ID: P21730
• Protein Sequence: Synthetic peptide located within the following region: SFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGV
• NCBI: NP_001727.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BPLP, PRL1, PROL1, opiorphin
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: C5AR1, Sample Tissue: COLO205 Whole Cell lysates, Antibody Dilution: 1 ug/ml.