You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581846 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to OMA1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OMA1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60 kDa |
Target | OMA1 |
UniProt ID | Q96E52 |
Protein Sequence | Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
NCBI | NP_660286 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DAB1, MPRP1, MPRP-1, YKR087C, ZMPOMA1, peptidase, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: HepG2 cells, Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit TBST with 5% BSA, Secondary dilution: 1:5000.
Host: Rabbit, Target Name: OMA1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: OMA1, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: OMA1, Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: OMA1, Positive control (+): 293T (2T), Negative control (-): Lung tumor (T-LU), Antibody concentration: 5 ug/ml.
Lanes: Lane 1: 10 ug human fibroblast mitochondria, Lane 2: 15 ug fish embryo lysate; 6 h post fertilization, Lane 3: 30 ug fish embryo lysate, 6 days, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: OMA1.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Filter by Rating