You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334499 |
---|---|
Category | Antibodies |
Description | OGT/O-Linked N-Acetylglucosamine Transferase Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine, Equine, Monkey, Rabbit |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 116925 MW |
UniProt ID | O15294 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | UDP-N-acetylglucosamine--peptide N-acetylglucosami Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U937 cells using anti-OGT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of RAW264.7 cells using anti-OGT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of OGT using anti-OGT antibody.Lane 1:human HeLa cell; 2:human PC-3 cell; 3:human A431 cell; 4:human A549 cell;5:human Caco-2 cell;6:human K562 cell;7:rat heart tissue;8:mouse heart tissue.
IF analysis of OGT using anti-OGT antibody. OGT was detected in immunocytochemical section of A431 cell.
IHC analysis of OGT using anti-OGT antibody. OGT was detected in a paraffin-embedded section of rat intestine tissue.
IHC analysis of OGT using anti-OGT antibody. OGT was detected in a paraffin-embedded section of mouse intestine tissue.
IHC analysis of OGT using anti-OGT antibody. OGT was detected in paraffin-embedded section of human gastric cancer tissue.
IHC analysis of OGT using anti-OGT antibody. OGT was detected in paraffin-embedded section of human pancreatic cancer tissue.
IHC analysis of OGT using anti-OGT antibody. OGT was detected in paraffin-embedded section of rat pancreas tissue.
ELISA, FC, IF, IHC, WB | |
Bovine, Canine, Mouse | |
Human, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Mouse | |
0.16-10 ng/mL | |
0.072 ng/mL |
Filter by Rating