You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291213 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human NXT1 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Immunogen | NXT1 (AAH00759.1, 1 a.a. ~ 140 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS |
NCBI | AAH00759.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Filter by Rating