NXT1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2291213
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human NXT1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: NXT1 (AAH00759.1, 1 a.a. ~ 140 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
• NCBI: AAH00759.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.