You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582946 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NUP43 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NUP43 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | NUP43 |
UniProt ID | Q8NFH3 |
Protein Sequence | Synthetic peptide located within the following region: HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI |
NCBI | NP_942590 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p42, bA350J20.1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
NUP43 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb582946 with 1:200 dilution. Western blot was performed using orb582946 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: NUP43 IP with orb582946 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-NUP43 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Thymus.
Filter by Rating