You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581342 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NTRK3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 89kDa |
Target | NTRK3 |
UniProt ID | Q16288 |
Protein Sequence | Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
NCBI | NP_002521 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TRKC, GP145-TrkC, gp145(trkC) Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NTRK3, Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: NTRK3, Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NTRK3, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Host: Rat, Target Name: NTRK3, Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Rabbit Anti-NTRK3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cerebellum, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-NTRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating