You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580531 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NSUN2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NSUN2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 86 kDa |
Target | NSUN2 |
UniProt ID | Q08J23 |
Protein Sequence | Synthetic peptide located within the following region: FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP |
NCBI | NP_060225 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MISU, MRT5, SAKI, TRM4 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An 85 kDa isoform also contains the peptide sequence. Protein may be modified by phosphorylation.
Host: Rabbit, Target: NSUN2, Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.
WB Suggested Anti-NSUN2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating