You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443177 |
---|---|
Category | Antibodies |
Description | NSE/ENO2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human NSE (LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 47 kDa |
UniProt ID | P09104 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Gamma-enolase; 2-phospho-D-glycerate hydro-lyase; Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-NSE antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of NSE using anti-NSE antibody.Lane 1:human 22RV1 Cell;2:human U20S Cell;3:human A431 Cell;4:human HepG2 Cell;5:human A549 Cell;6:human SHG-44 Cell;7:rat brain tissue;8:mouse brain tissue.
IF analysis of NSE using anti-NSE antibody. NSE was detected in immunocytochemical section of A431 cells.
IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of rat brain tissue.
IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of human pancreatic cancer tissue.
Filter by Rating