NRF1 monoclonal antibody (M01), clone 2F9

• Catalog Number: orb2292491
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NRF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse
• Isotype: IgG1 Kappa
• Immunogen: NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
• NCBI: NP_005002
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NRF1 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to NRF1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in HeLa.

NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in human Skeletal muscle.

Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M01), clone 2F9. Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of NRF1 over-expressed 293 cell line, cotransfected with NRF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NRF1 monoclonal antibody (M01), clone 2F9 (Cat # orb2292491). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.09 KDa).