NRF1 Rabbit Polyclonal Antibody

• Catalog Number: orb576728
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NRF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: NRF1
• UniProt ID: Q16656
• Protein Sequence: Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED
• NCBI: NP_005002
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ALPHA-PAL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Hum. Fetal Liver

NRF1 antibody - N-terminal region (orb576728) validated by WB using Mouse endothelial cells at 1:500.

WB Suggested Anti-NRF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T. There is BioGPS gene expression data showing that NRF1 is expressed in HEK293T.