You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573922 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR5A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR5A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52kDa |
Target | NR5A1 |
UniProt ID | Q13285 |
Protein Sequence | Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP |
NCBI | NP_004950 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ELP, SF1, FTZ1, POF7, SF-1, AD4BP, FTZF1, SPGF8, S Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: NR5A1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Human kidney
Human Liver
WB Suggested Anti-NR5A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate, NR5A1 is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-NR5A1 antibody Titration: 1 ug/ml, Sample Type: Human heart.
FC, IHC-P, WB | |
Bovine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |
IHC-P | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |
IHC-P | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating