NR5A1 antibody

• Catalog Number: orb573922
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR5A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NR5A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: NR5A1
• UniProt ID: Q13285
• Protein Sequence: Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP
• NCBI: NP_004950
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ELP, SF1, FTZ1, POF7, SF-1, AD4BP, FTZF1, SPGF8, S
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NR5A1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NR5A1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Human kidney

Human Liver

WB Suggested Anti-NR5A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate, NR5A1 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-NR5A1 antibody Titration: 1 ug/ml, Sample Type: Human heart.