NR4A2 monoclonal antibody (M07), clone 4A6

• Catalog Number: orb2292486
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NR4A2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A6
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: NR4A2 (AAH66890, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP
• NCBI: AAH66890
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NR4A2 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NR4A2 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of NR4A2 expression in transfected 293T cell line by NR4A2 monoclonal antibody (M07), clone 4A6. Lane 1: NR4A2 transfected lysate (Predicted MW: 66.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).