NR4A2 Rabbit Polyclonal Antibody

• Catalog Number: orb330013
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR4A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR4A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: NR4A2
• UniProt ID: P43354
• Protein Sequence: Synthetic peptide located within the following region: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE
• NCBI: NP_006177
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HZF-3 antibody, anti NOT antibody, anti NURR1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry of formalin-fixed, paraffin-embedded human adrenal tissue after heat-induced antigen retrieval. NR4A2 Antibody (orb330013) concentration 5 ug/mL.

Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. NR4A2 Antibody (orb330013) concentration 5 ug/mL.

Lanes: Lane 1: Nuclear fraction from mouse substantia nigra, Lane 2: Nuclear fraction from mouse substantia nigra, Lane 3: Nuclear fraction from mouse cortex, Lane 4: Nuclear fraction from mouse cortex, Primary Antibody Dilution: 1:400, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:10000, Gene Name: NR4A2.

WB Suggested Anti-NR4A2 Antibody Titration: 1 ug/mL, Positive Control: Hela cell lysate.