NR4A2 Rabbit Polyclonal Antibody

• Catalog Number: orb329685
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR4A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NR4A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67 kDa
• Target: NR4A2
• UniProt ID: P43354
• Protein Sequence: Synthetic peptide located within the following region: NGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLF
• NCBI: NP_006177
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HZF-3 antibody, anti NOT antibody, anti NURR1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Multiple isoforms between 59 and 75 kDa contain the peptide sequence.

Rabbit Anti-NR4A2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Breast, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-NR4A2 Antibody, Catalog Number: orb329685, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-NR4A2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.