NR2F2 antibody

• Catalog Number: orb592890
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR2F2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Mouse, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: NR2F2
• UniProt ID: P24468
• Protein Sequence: Synthetic peptide located within the following region: AMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAST
• NCBI: NP_066285
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NR2F2, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: NR2F2, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: NR2F2, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-NR2F2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

WB Suggested Anti-NR2F2 antibody Titration: 1 ug/ml, Sample Type: Human heart.