NR2E1 antibody

• Catalog Number: orb574040
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR2E1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43 kDa
• Target: NR2E1
• UniProt ID: Q9Y466
• Protein Sequence: Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
• NCBI: NP_003260
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TLL, TLX, XTLL
• Note: For research use only
• Application notes: Application Info: IHC Information: Colon, myenteric plexus
• Expiration Date: 12 months from date of receipt.

25 ug of Hela and MCF7 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

Host: Rabbit, Target Name: NR2E1, Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: NR2E1, Sample Tissue: Human NCI-H226 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: NR2E1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Human Brain

Human Placenta

Human Prostate

WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Muscle cell lysate.