NR2C2 Rabbit Polyclonal Antibody

• Catalog Number: orb580247
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR2C2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NR2C2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: NR2C2
• UniProt ID: P49116
• Protein Sequence: Synthetic peptide located within the following region: AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS
• NCBI: NP_003289
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TR4, TAK1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Skin

NR2C2 antibody - C-terminal region (orb580247) validated by WB using HepG2 cell lysate at 2.5 ug/ml.