You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579515 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR1I3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | NR1I3 |
UniProt ID | Q5VTW5 |
Protein Sequence | Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
NCBI | NP_005113 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAR, CAR1, MB67 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: NR1I3, Positive control (+): Human liver (LI), Negative control (-): Human stomach (ST), Antibody concentration: 5 ug/ml.
Human Liver
WB Suggested Anti-NR1I3 Antibody Titration: 1.25 ug/ml, Positive Control: Human Liver.
ELISA, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating