NR1I3 antibody

• Catalog Number: orb579515
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR1I3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: NR1I3
• UniProt ID: Q5VTW5
• Protein Sequence: Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA
• NCBI: NP_005113
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAR, CAR1, MB67
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: NR1I3, Positive control (+): Human liver (LI), Negative control (-): Human stomach (ST), Antibody concentration: 5 ug/ml.

Human Liver

WB Suggested Anti-NR1I3 Antibody Titration: 1.25 ug/ml, Positive Control: Human Liver.