You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575750 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR1I2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50 kDa |
Target | NR1I2 |
UniProt ID | O75469 |
Protein Sequence | Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA |
NCBI | NP_003880 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR1I2, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: NR1I2, Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NR1I2, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 5 ug/ml.
Host: Rabbit, Target: NR1I2, Positive control (+): HepG2 (HG), Negative control (-): MCF7 (N10), Antibody concentration: 0.3 ug/ml.
Immunohistochemistry with Human Small Intestine tissue at an antibody concentration of 5.0 ug/ml using anti-NR1I2 antibody (orb575750).
WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.
WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human heart.
ICC, IF, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating