You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576783 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR1H3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NR1H3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50 kDa |
Target | NR1H3 |
UniProt ID | Q13133 |
Protein Sequence | Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD |
NCBI | NP_005684 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LXRA, LXR-a, RLD-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is also present in a 28 kDa isoform.
Host: Mouse, Target Name: NR1H3, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-NR1H3 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
ELISA, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating