NR1H2 antibody

• Catalog Number: orb576881
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR1H2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR1H2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: NR1H2
• UniProt ID: Q68CY8
• Protein Sequence: Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD
• NCBI: NP_009052
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NER, UNR, LXRB, LXR-b, NER-I, RIP15
• Note: For research use only
• Application notes: Application Info: ChIP
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NR1H2, Sample Tissue: Human 721_B, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target: NR1H2, Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-NR1H2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.