NR0B1 antibody

• Catalog Number: orb573871
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR0B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NR0B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: NR0B1
• UniProt ID: Q9BG96
• Protein Sequence: Synthetic peptide located within the following region: QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ
• NCBI: NP_000466
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AHC, AHX, DSS, GTD, HHG, AHCH, DAX1, DAX-1, NROB1,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: NR0B1, Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Kidney (M-KI), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NR0B1 antibody (orb573871).

WB Suggested Anti-NR0B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.