You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573871 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR0B1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR0B1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52kDa |
Target | NR0B1 |
UniProt ID | Q9BG96 |
Protein Sequence | Synthetic peptide located within the following region: QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ |
NCBI | NP_000466 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AHC, AHX, DSS, GTD, HHG, AHCH, DAX1, DAX-1, NROB1, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: NR0B1, Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Kidney (M-KI), Antibody concentration: 1 ug/ml.
Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NR0B1 antibody (orb573871).
WB Suggested Anti-NR0B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.
Filter by Rating