NPY1R antibody

• Catalog Number: orb578234
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NPY1R
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPY1R
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44 kDa
• Target: NPY1R
• UniProt ID: P25929
• Protein Sequence: Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI
• NCBI: NP_000900
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NPYR, NPY1-R
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with gut tissue.

Immunohistochemistry with gut tissue.

Immunohistochemistry with gut tissue.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NPY1R antibody (orb578234).