NP antibody

• Catalog Number: orb580414
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: PNP
• UniProt ID: P00491
• Protein Sequence: Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG
• NCBI: NP_000261
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NP, PUNP, PRO1837
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: PNP, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: PNP, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PNP, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PNP, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PNP is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-NP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.