You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580414 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | PNP |
UniProt ID | P00491 |
Protein Sequence | Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
NCBI | NP_000261 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NP, PUNP, PRO1837 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PNP, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PNP, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PNP, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PNP, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PNP is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-NP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.
ELISA, IF, IHC-P, WB | |
Guinea pig | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA | |
Other | |
Monoclonal | |
Unconjugated |
FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating